PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G053100.1
Common NameB456_007G053100, LOC105802212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 346aa    MW: 38664.7 Da    PI: 6.5185
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G053100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.1e-31217272156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+ Fv+a++qLGGs++AtPk+i+e+m+v++Lt+++vkSHLQkYRl+
  Gorai.007G053100.1 217 KQRRCWSPELHRLFVDALQQLGGSQVATPKQIKEVMQVDDLTNDEVKSHLQKYRLH 272
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-28214275IPR009057Homeodomain-like
PROSITE profilePS5129413.123214274IPR017930Myb domain
SuperFamilySSF466895.82E-18215275IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-26217272IPR006447Myb domain, plants
PfamPF002492.8E-7219270IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MELSLDLSSV FVPKTITEFL KEASKIKDGF QKSSKISDYV KRLEDEMKKI DGFKRELPLC  60
MLLLKDGIER LKVEEVQCKE TDDGLPLKEN DDSDKTNWLS SVQLWNSDFN IVDHNKKPNT  120
VSELKPRSGR EEEEDMSENP IKVCNSKSRG GAFVPFKDIS GIPLMNPSFE LVSCNGILRN  180
NGGCTIGSGS SLTAEKTHIK FQTESQDQQK QQQSSRKQRR CWSPELHRLF VDALQQLGGS  240
QVATPKQIKE VMQVDDLTND EVKSHLQKYR LHIRKLPPSS ARNQCNENMK SQSGSPQCPL  300
TVSALAKGMS STGGDSMDGE DDEKSDGLSW RSGVHKPGEI ECIVR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5271018e-50HQ527101.1 Gossypium herbaceum clone NBRI_D_EYT27PB02DTG6D simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489168.10.0PREDICTED: uncharacterized protein LOC105802212
TrEMBLA0A0D2P3D00.0A0A0D2P3D0_G
STRINGPOPTR_0007s11470.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-61G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]